PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012608-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 303aa    MW: 34752.1 Da    PI: 6.172
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012608-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.1e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++ +G g+W++ a+  g++Rt+k+c++rw++yl
    NNU_012608-RA 19 RGPWTLEEDTLLIHYIACHGEGRWNLLAKSSGLKRTGKSCRLRWLNYL 66
                     89********************************************97 PP

2Myb_DNA-binding53.94.2e-1772115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
    NNU_012608-RA  72 RGNLTPEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 115
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4591466IPR017930Myb domain
SuperFamilySSF466894.49E-3116113IPR009057Homeodomain-like
SMARTSM007174.5E-141868IPR001005SANT/Myb domain
PfamPF002491.4E-151966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-222073IPR009057Homeodomain-like
CDDcd001672.12E-102166No hitNo description
PROSITE profilePS5129425.6367121IPR017930Myb domain
SMARTSM007172.5E-1571119IPR001005SANT/Myb domain
PfamPF002495.3E-1672115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2474120IPR009057Homeodomain-like
CDDcd001671.94E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MSTPKSLYSY GEEDVELRRG PWTLEEDTLL IHYIACHGEG RWNLLAKSSG LKRTGKSCRL  60
RWLNYLKPDV KRGNLTPEEQ LLILELHSRW GNRWSKIAQH LPGRTDNEIK NYWRTRVQKQ  120
ARHLKIDANS ARFRDAIRCF WMPRLLQKIE DSSLAMINQN SSSSPIPLNL QIPQPSPLPP  180
PPEVSLSVSE PTDSINLQEK NCTSPSISSS DSMNISKFPE FSEYPTTSSL LLHDFGNIVY  240
NPYVDNSSYD MDDFNTSVMS LQGGYEASDC HMAESNWVGN DVAESIWSID ELWQFRKLQD  300
RGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26161211105MYB PROTO-ONCOGENE PROTEIN
1h8a_C2e-261612124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00159DAPTransfer from AT1G25340Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265100.10.0PREDICTED: myb-related protein MYBAS2-like
TrEMBLD7SJ031e-125D7SJ03_VITVI; Putative uncharacterized protein
STRINGVIT_17s0000g03560.t011e-125(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.11e-83myb domain protein 116